SERCA3 (ATP2A3) mouse monoclonal antibody, clone 2H3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
SERCA3 (ATP2A3) mouse monoclonal antibody, clone 2H3, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-ATP2A3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP2A3 antibody: synthetic peptide directed towards the middle region of human ATP2A3. Synthetic peptide located within the following region: LISGWLFFRYLAIGVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCS |
ATP2A3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 360-600 of human ATP2A3 (NP_005164.2). |
Modifications | Unmodified |