AMCase (CHIA) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 20-47 amino acids from the N-terminal region of human CHIA. |
AMCase (CHIA) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 20-47 amino acids from the N-terminal region of human CHIA. |
Rabbit Polyclonal anti-CHIA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHIA antibody: synthetic peptide directed towards the N terminal of human CHIA. Synthetic peptide located within the following region: MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL |
Rabbit Polyclonal anti-CHIA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CHIA antibody: synthetic peptide directed towards the middle region of human CHIA. Synthetic peptide located within the following region: GSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFP |
Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI3H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI3D8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI3G3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CHIA mouse monoclonal antibody,clone OTI1B8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CHIA Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human CHIA (NP_001244932.1). |
Modifications | Unmodified |
CHIA Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-368 of human CHIA (NP_001244932.1). |
Modifications | Unmodified |
CHIA mouse monoclonal antibody,clone OTI3H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHIA mouse monoclonal antibody,clone OTI3H4, Biotinylated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CHIA mouse monoclonal antibody,clone OTI3H4, HRP conjugated
Applications | IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CHIA mouse monoclonal antibody,clone OTI3H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CHIA mouse monoclonal antibody,clone OTI3D8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHIA mouse monoclonal antibody,clone OTI3D8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CHIA mouse monoclonal antibody,clone OTI3D8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
CHIA mouse monoclonal antibody,clone OTI3D8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CHIA mouse monoclonal antibody,clone OTI3G3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHIA mouse monoclonal antibody,clone OTI3G3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CHIA mouse monoclonal antibody,clone OTI3G3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
CHIA mouse monoclonal antibody,clone OTI3G3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CHIA mouse monoclonal antibody,clone OTI1B8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CHIA mouse monoclonal antibody,clone OTI1B8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
CHIA mouse monoclonal antibody,clone OTI1B8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
CHIA mouse monoclonal antibody,clone OTI1B8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |