Rabbit Polyclonal Anti-PSMD14 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the N terminal of human PSMD14. Synthetic peptide located within the following region: MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVP |
Rabbit Polyclonal Anti-PSMD14 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the C terminal of human PSMD14. Synthetic peptide located within the following region: EEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK |
Anti-PSMD14 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
Anti-PSMD14 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
PSMD14 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-300 of human PSMD14 (NP_005796.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
