Antibodies

View as table Download

Rabbit Polyclonal Anti-RIC8A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RIC8A antibody: synthetic peptide directed towards the N terminal of human RIC8A. Synthetic peptide located within the following region: KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL

Rabbit Polyclonal antibody to RIC8A (resistance to inhibitors of cholinesterase 8 homolog A (C. elegans))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 478 and 531 of RIC8A

Goat Polyclonal Antibody against RIC8A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CLSSDPDSDPD, from the C Terminus of the protein sequence according to NP_068751.4.

Carrier-free (BSA/glycerol-free) RIC8A mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RIC8A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RIC8A

RIC8A Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 362-531 of human RIC8A (NP_001273063.1).
Modifications Unmodified

Anti-RIC8A (RIC8) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-RIC8A (RIC8) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-RIC8A (RIC8) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-RIC8A (RIC8) mouse monoclonal antibody, clone OTI3G3 (formerly 3G3)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated