Antibodies

View as table Download

Mouse Monoclonal Sonic Hedgehog/Shh Antibody (5H4)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Rabbit Polyclonal Sonic Hedgehog/Shh Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465]

Sonic Hedgehog (SHH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence near the N-terminal of human SHH

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SHH mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

SHH Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SHH

Sonic Hedgehog (Shh) Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human Sonic Hedgehog (Sonic Hedgehog (Shh))
Modifications Unmodified

SHH Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of Mouse SHH.

Sonic Hedgehog (Shh) Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human Sonic Hedgehog (Sonic Hedgehog (Shh))
Modifications Unmodified

Sonic Hedgehog Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthesized peptide derived from human Shh

Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

SHH (Sonic Hedgehog) mouse monoclonal antibody, clone OTI10H6 (formerly 10H6)

Applications IF, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated