Antibodies

View as table Download

Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561)

Rabbit Monoclonal Antibody against CASP3 (Clone E87)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal SDHD Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SDHD antibody was raised against a 15 amino acid synthetic peptide near the center of human SDHD.

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

Rabbit polyclonal anti-VDAC1/Porin antibody, Loading control

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 211 of VDAC1 (Uniprot ID#P21796)

Rabbit polyclonal APAF-1-ALT antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human APAF-1-ALT.

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Rabbit polyclonal anti-NDUFA4L2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2.

Goat Polyclonal Antibody against PPID / CyP-40

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DENFHYKHDREG, from the internal region of the protein sequence according to NP_005029.1.

Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L).
Modifications Phospho-specific

Rabbit Polyclonal Anti-SDHB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SDHB