Rabbit anti-SPAM1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SPAM1 |
Rabbit anti-SPAM1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SPAM1 |
Rabbit anti-GLB1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GLB1 |
Rabbit anti-HPSE Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HPSE |
Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 318 and 496 of SGSH (Uniprot ID#P51688) |
Rabbit anti-GALNS Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GALNS |
Rabbit polyclonal anti-GUSB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GUSB. |
Rabbit polyclonal GALNS Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This GALNS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-263 amino acids from the Central region of human GALNS. |
Rabbit anti-HEXA Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HEXA |
Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 44 and 230 of SGSH (Uniprot ID#P51688) |
Anti-HPSE Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a C terminal 250 amino acids of human heparanase |
Rabbit Polyclonal ARSB Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ARSB antibody was raised against a 16 amino acid peptide near the carboxy terminus of human ARSB |
Anti-HPSE Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a C terminal 250 amino acids of human heparanase |
Rabbit polyclonal anti-ARSB antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ARSB. |
Rabbit Polyclonal Anti-IDUA Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Idua antibody is: synthetic peptide directed towards the middle region of MOUSE Idua. Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH |