Antibodies

View as table Download

Rabbit anti-SPAM1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SPAM1

Rabbit anti-GLB1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLB1

Rabbit anti-HPSE Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HPSE

Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 318 and 496 of SGSH (Uniprot ID#P51688)

Rabbit anti-GALNS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GALNS

Rabbit polyclonal anti-GUSB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GUSB.

Rabbit polyclonal GALNS Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GALNS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-263 amino acids from the Central region of human GALNS.

Rabbit anti-HEXA Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HEXA

Rabbit polyclonal antibody to SGSH (N-sulfoglucosamine sulfohydrolase)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 44 and 230 of SGSH (Uniprot ID#P51688)

Anti-HPSE Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 250 amino acids of human heparanase

Rabbit Polyclonal ARSB Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ARSB antibody was raised against a 16 amino acid peptide near the carboxy terminus of human ARSB

Anti-HPSE Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 250 amino acids of human heparanase

Rabbit polyclonal anti-ARSB antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ARSB.

Rabbit Polyclonal Anti-IDUA Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Idua antibody is: synthetic peptide directed towards the middle region of MOUSE Idua. Synthetic peptide located within the following region: MENQLLPGFELMGSPSGYFTDFDDKQQVFEWKDLVSLLARRYIGRYGLTH