Germany
Japan
United Kingdom
China
Goat Anti-ALDH5A1 (aa 301-312) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TGKILLHHAANS, from the internal region of the protein sequence according to NP_733936.1; NP_001071.1. |
Antibodies
View as table Download
Anti-GAD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 185 amino acids of human glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa) |
Anti-GAD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.148~152 (E-L-A-D-Q) derived from Human GAD65 (GAD2). |
Rabbit polyclonal GPT Antibody (N-term R133)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This GPT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 118-144 amino acids from the N-terminal region of human GPT. |
Rabbit anti-GAD1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human GAD1 |
Rabbit polyclonal Anti-ASPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASPA antibody: synthetic peptide directed towards the N terminal of human ASPA. Synthetic peptide located within the following region: RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS |
Rabbit polyclonal Anti-ASPA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASPA antibody: synthetic peptide directed towards the middle region of human ASPA. Synthetic peptide located within the following region: IKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADIL |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GAD1 Antibody: synthetic peptide directed towards the N terminal of human GAD1. Synthetic peptide located within the following region: MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF |
Rabbit Polyclonal Anti-Aldh4a1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Aldh4a1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GSGLRWKHASSLKVANEPILAFTQGSPERDALQKALNDLKDQTEAIPCVV |
Rabbit Polyclonal Anti-IL4I1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL4I1 antibody is: synthetic peptide directed towards the C-terminal region of Human IL4I1. Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS |
Rabbit Polyclonal Anti-CAD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAD antibody: synthetic peptide directed towards the C terminal of human CAD. Synthetic peptide located within the following region: ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL |
Rabbit Polyclonal Anti-ABAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT |
Rabbit Polyclonal Anti-ABAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABAT antibody: synthetic peptide directed towards the middle region of human ABAT. Synthetic peptide located within the following region: IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW |
Rabbit Polyclonal Anti-ALDH5A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALDH5A1 antibody: synthetic peptide directed towards the middle region of human ALDH5A1. Synthetic peptide located within the following region: AFFLEWFSEEARRVYGDIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAM |
Rabbit Polyclonal Anti-ADSL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADSL antibody: synthetic peptide directed towards the middle region of human ADSL. Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI |
Rabbit Polyclonal Anti-ASNS Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASNS antibody: synthetic peptide directed towards the C terminal of human ASNS. Synthetic peptide located within the following region: SVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADR |
Goat Anti-ALDH5A1 (aa 485-496), Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SQDPAQIWRVAE., from the internal region of the protein sequence according to NP_733936.1; NP_001071.1. |
Anti-AGXT Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 280-294 amino acids of human alanine-glyoxylate aminotransferase |
Anti-ALDH4A1 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human aldehyde dehydrogenase 4 family, member A1 |
Rabbit Polyclonal Anti-ASPA Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASPA |
Rabbit Polyclonal Anti-ASNS Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASNS |
USD 345.00
4 Weeks
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
Active filters
Applications
- WB
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- aspartate and glutamate metabolism