Antibodies

Jump to Filters
View as table Download
CCR4 (Extracell. Dom.) Goat Polyclonal Antibody
AP23074PU-N

USD 440.00

2 Weeks

CCR4 (Extracell. Dom.) goat polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic corresponding to Human CCR4 extracellular domain.
Epitope: Extracellular Domain.
CCR4 Rabbit Polyclonal Antibody
TA330377

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL
CCR4 Rabbit Polyclonal Antibody
AP26357PU-N

USD 355.00

3 Weeks

CCR4 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Canine, Human, Mouse
Immunogen Synthetic peptide surrounding amino acid 32 of human CCR4
CCR4 Rabbit Polyclonal Antibody
TA374396

USD 220.00

3 Weeks

CCR4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR4 (NP_005499.1).