Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-Keratin 14 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keratin 14 Antibody: A synthesized peptide derived from human Keratin 14 |
Antibodies
View as table Download
Cytokeratin 14 (KRT14) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human KRT14 |
Rabbit Polyclonal Anti-KRT14 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT14 antibody: synthetic peptide directed towards the C terminal of human KRT14. Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN |
Anti-KRT14 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 457-472 amino acids of Human Keratin, type I cytoskeletal 14 |
Cytokeratin 14 (KRT14) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human Cytokeratin 14 (Cytokeratin 14 (KRT14)) (NP_000517.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KRT14
Applications
- WB
Clonalities
- Polyclonal