Neurotrophin 3 (NTF3) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide mapping at the middle region of Human Neurotrophin-3 |
Neurotrophin 3 (NTF3) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide mapping at the middle region of Human Neurotrophin-3 |
Rabbit Polyclonal Anti-NT3
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide GEIKTGNSPV(C), corresponding to amino acid residues 39-48 of mature human NT-3 (residues 177-186 of the NT-3 precursor). |
Rabbit Polyclonal Anti-proNT-3
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DTELLRQQRRYNSPR, corresponding to amino acid residues 89-103 of human NT-3 (precursor).Pro domain of the NT-3 protein. |
Rabbit polyclonal anti-NT-3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant human NT-3 |
Rabbit polyclonal Anti-Ntf3 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY |
NTF3 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-257 of human NTF3 (NP_002518.1). |
Modifications | Unmodified |
NT-3 Antibody
Applications | ELISA, Neutralize, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Produced from sera of rabbits pre-immunized with highly pure (>98%) recombinant hNT-3. Anti-Human NT-3 specific antibody was purified by affinity chromatography employing immobilized hNT-3 matrix. |
NT-3 Antibody (biotin)
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Produced from sera of rabbits pre-immunized with highly pure (>98%) recombinant hNT-3. Anti-Human NT-3 specific antibody was purified by affinity chromatography and then biotinylated. |