Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-NT-3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human NT-3 |
Rabbit polyclonal Anti-Ntf3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY |
NTF3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-257 of human NTF3 (NP_002518.1). |
| Modifications | Unmodified |
NT-3 Antibody
| Applications | ELISA, Neutralize, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Produced from sera of rabbits pre-immunized with highly pure (>98%) recombinant hNT-3. Anti-Human NT-3 specific antibody was purified by affinity chromatography employing immobilized hNT-3 matrix. |
NT-3 Antibody (biotin)
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Produced from sera of rabbits pre-immunized with highly pure (>98%) recombinant hNT-3. Anti-Human NT-3 specific antibody was purified by affinity chromatography and then biotinylated. |
Active filters
Target Symbol
- NTF3
Applications
- WB
Clonalities
- Polyclonal