Rabbit Polyclonal Anti-PPIL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIL3 antibody: synthetic peptide directed towards the middle region of human PPIL3. Synthetic peptide located within the following region: NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR |
Rabbit Polyclonal Anti-Ppil3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ppil3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Ppil3. Synthetic peptide located within the following region: HLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF |
Rabbit Polyclonal Anti-PPIL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIL3 antibody: synthetic peptide directed towards the middle region of human PPIL3. Synthetic peptide located within the following region: AGVQWRDLGSLQPPPPGFKQVFCLSLPRTGRGGNSIWGKKFEDEYSEYLK |
Germany
Japan
United Kingdom
China