Rabbit Polyclonal Anti-Rasa1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rasa1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT |
RASA1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 965-993 amino acids from the C-terminal region of Human RASA1 / RasGAP. |
RASA1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 140-220 of human RASA1 (NP_002881.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China