Rabbit Polyclonal Anti-TRIM21 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TRIM21 antibody was raised against an 16 amino acid peptide near the center of human TRIM21. |
Rabbit Polyclonal Anti-TRIM21 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TRIM21 antibody was raised against an 16 amino acid peptide near the center of human TRIM21. |
Rabbit polyclonal SREBF2 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SREBF2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 399-427 amino acids from the Central region of human SREBF2. |
Rabbit Polyclonal Anti-SREBF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: VMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIEL |
Rabbit Polyclonal Anti-SREBF2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL |
SREBP2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human SREBF2 (NP_004590.2). |
Modifications | Unmodified |