Antibodies

View as table Download

Rabbit polyclonal NRG1 isoform-10 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NRG1 isoform-10.

NRG1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NRG1

Rabbit Polyclonal Anti-NRG1 isoform-10 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NRG1 isoform-10 Antibody: A synthesized peptide derived from human NRG1 isoform-10

Anti-Human Heregulinβ-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Heregulinβ-1

Rabbit Polyclonal Anti-NRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the N terminal of human NRG1. Synthetic peptide located within the following region: YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS

Rabbit Polyclonal Anti-NRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human NRG1. Synthetic peptide located within the following region: SEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEV

Rabbit Polyclonal Anti-NRG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1

Rabbit Polyclonal Anti-NRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human NRG1