Antibodies

Jump to Filters
View as table Download
PDE3B Rabbit Polyclonal Antibody
TA319015

USD 355.00

3 Weeks

Rabbit polyclonal anti-PDE3B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 948 of mouse PDE3B.
PDE3B Rabbit Polyclonal Antibody
TA335263

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDE3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN