Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ADAM29 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADAM29 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADAM29. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ADRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRM1 antibody: synthetic peptide directed towards the C terminal of human ADRM1. Synthetic peptide located within the following region: QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDE |
Rabbit Polyclonal Anti-ADRM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADRM1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADRM1. Synthetic peptide located within the following region: PSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALG |
ADRM1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1 |
ADRM1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ADRM1 |
ADRM1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 108-407 of human ADRM1 (NP_008933.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ADRM1
Applications
- WB
Conjugates
- Unconjugated