ADRM1 Rabbit Polyclonal Antibody

CAT#: TA342592

Rabbit Polyclonal Anti-ADRM1 Antibody

Product Images

Host: Rabbit; Target Name: ADRM1; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml ADRM1 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADRM1 antibody is: synthetic peptide directed towards the N-terminal region of Human ADRM1. Synthetic peptide located within the following region: PSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: adhesion regulating molecule 1
• Database Link:
  NP_783163
  Entrez Gene 11047 Human
  UniProt ID Q16186
• Background: The protein encoded by this gene is an integral plasma membrane protein which promotes cell adhesion. The encoded protein is thought to undergo O-linked glycosylation. Expression of this gene has been shown to be induced by gamma interferon in some cancer cells. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: ARM-1; ARM1; GP110
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 79%