Rabbit Polyclonal Anti-ANXA3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA3 |
Rabbit Polyclonal Anti-ANXA3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ANXA3 |
Rabbit Polyclonal Anti-ANXA3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the N terminal of human ANXA3. Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN |
Rabbit Polyclonal Anti-ANXA3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANXA3 antibody: synthetic peptide directed towards the C terminal of human ANXA3. Synthetic peptide located within the following region: RIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGDD |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ANXA3 mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human ANXA3 (NP_005130.1). |
Modifications | Unmodified |
ANXA3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human ANXA3 (NP_005130.1). |
Modifications | Unmodified |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI8A12 (formerly 8A12)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ANXA3 (Annexin A3) mouse monoclonal antibody, clone OTI5G4 (formerly 5G4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |