Rabbit anti-BCHE Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BCHE |
Rabbit anti-BCHE Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BCHE |
Rabbit Polyclonal Anti-BCHE Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BCHE antibody: synthetic peptide directed towards the N terminal of human BCHE. Synthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) BCHE mouse monoclonal antibody, clone OTI4C12 (formerly 4C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) BCHE mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | FC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
USD 379.00
In Stock
BCHE (Butyrylcholinesterase) mouse monoclonal antibody, clone OTI4C12 (formerly 4C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
In Stock
BCHE (Butyrylcholinesterase) mouse monoclonal antibody, clone OTI4C12 (formerly 4C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
BCHE (Butyrylcholinesterase) mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | FC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
USD 159.00
2 Days
BCHE (Butyrylcholinesterase) mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | FC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |