Antibodies

View as table Download

Rabbit anti-BCHE Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BCHE

Rabbit Polyclonal Anti-BCHE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BCHE antibody: synthetic peptide directed towards the N terminal of human BCHE. Synthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ

Carrier-free (BSA/glycerol-free) BCHE mouse monoclonal antibody, clone OTI4C12 (formerly 4C12)

Applications WB
Reactivities Human
Conjugation Unconjugated

BCHE (Butyrylcholinesterase) mouse monoclonal antibody, clone OTI4C12 (formerly 4C12)

Applications WB
Reactivities Human
Conjugation Unconjugated

BCHE (Butyrylcholinesterase) mouse monoclonal antibody, clone OTI4C12 (formerly 4C12)

Applications WB
Reactivities Human
Conjugation Unconjugated