Antibodies

View as table Download

Rabbit polyclonal antibody to CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1625 and 1930 of CAD (Uniprot ID#P27708)

Rabbit Polyclonal Anti-CAD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAD antibody: synthetic peptide directed towards the N terminal of human CAD. Synthetic peptide located within the following region: AALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILV

Rabbit Polyclonal Anti-CAD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAD antibody: synthetic peptide directed towards the C terminal of human CAD. Synthetic peptide located within the following region: ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL

Carrier-free (BSA/glycerol-free) CAD mouse monoclonal antibody,clone OTI10A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CAD mouse monoclonal antibody,clone OTI1A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

cad Antibody - middle region

Applications WB
Reactivities Fruit fly
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide corresponding to a region of Fruit fly

CAD Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1650-1900 of human CAD (NP_004332.2).
Modifications Unmodified

CAD mouse monoclonal antibody,clone OTI10A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CAD mouse monoclonal antibody,clone OTI10A3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CAD mouse monoclonal antibody,clone OTI1A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CAD mouse monoclonal antibody,clone OTI1A7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal anti-CAD Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CAD

Rabbit Polyclonal anti-CAD Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CAD