CIR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CIR1 |
CIR1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CIR1 |
Rabbit Polyclonal Anti-CIR1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CIR1 antibody is: synthetic peptide directed towards the middle region of Human CIR1. Synthetic peptide located within the following region: GRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKK |
Rabbit Polyclonal Anti-CIR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CIR antibody: synthetic peptide directed towards the middle region of human CIR. Synthetic peptide located within the following region: SGFALKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLR |
Rabbit Polyclonal Anti-CIR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CIR antibody: synthetic peptide directed towards the C terminal of human CIR. Synthetic peptide located within the following region: RSRSPGSYKQRETRKRAQRNPGEEQSRRNDSRSHGTDLYRGEKMYREHPG |
CIR1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human CIR1 (NP_004873.3). |
Modifications | Unmodified |