Antibodies

View as table Download

CLU rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLU

Rabbit anti-CLU Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLU

Goat Polyclonal Antibody against CLU

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKALQEYRKKHREE, from the C Terminus of the protein sequence according to NP_001822.2; NP_976084.1.

Goat Anti-Clusterin / ApoJ (mouse) Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKALQEYRRKSRAE, from the C Terminus of the protein sequence according to NP_038520.1.

Anti-CLU Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 230 amino acids of human clusterin

Rabbit Polyclonal Anti-CLU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN

Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-CLU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLU

Clusterin alpha chain Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human Clusterin alpha chain (NP_001822.3).
Modifications Unmodified

Clusterin alpha chain Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 220-449 of human Clusterin alpha chain (NP_976084.1).
Modifications Unmodified

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CLU mouse monoclonal antibody, clone OTI5D3 (formerly 5D3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated