CRP Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CRP |
CRP Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CRP |
C Reactive Protein (CRP) mouse monoclonal antibody, clone S5G1, Aff - Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CRP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CRP antibody: synthetic peptide directed towards the N terminal of human CRP. Synthetic peptide located within the following region: MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA |
C Reactive Protein (CRP) mouse monoclonal antibody, clone N1G1, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti CRP (IN) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of human CRP protein (from 32aa-41aa). This sequence is identical to human and mouse. |
Rabbit anti CRP (NT) Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of human CRP protein (from 42aa-49aa). |
Rabbit anti CRP (NT) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of human CRP protein (from 67aa-75aa). This sequence is identical to human, mouse and rat. |
Carrier-free (BSA/glycerol-free) CRP mouse monoclonal antibody,clone OTI1H1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CRP mouse monoclonal antibody,clone OTI4G8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CRP mouse monoclonal antibody,clone OTI4B4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CRP mouse monoclonal antibody,clone OTI7C10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CRP mouse monoclonal antibody,clone OTI7C3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CRP mouse monoclonal antibody,clone OTI6F3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CRP mouse monoclonal antibody,clone OTI1G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CRP Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-91 amino acids of human C-reactive protein, pentraxin-related |
Anti-CRP Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-91 amino acids of human C-reactive protein, pentraxin-related |
C-Reactive Protein (CRP) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human C-Reactive Protein (C-Reactive Protein (CRP)) |
Modifications | Unmodified |
CRP mouse monoclonal antibody,clone OTI1H1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRP mouse monoclonal antibody,clone OTI1H1
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CRP mouse monoclonal antibody,clone OTI4G8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRP mouse monoclonal antibody,clone OTI4G8
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CRP mouse monoclonal antibody,clone OTI4B4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRP mouse monoclonal antibody,clone OTI4B4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CRP mouse monoclonal antibody,clone OTI7C10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRP mouse monoclonal antibody,clone OTI7C10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CRP mouse monoclonal antibody,clone OTI7C3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRP mouse monoclonal antibody,clone OTI7C3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CRP mouse monoclonal antibody,clone OTI6F3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRP mouse monoclonal antibody,clone OTI6F3
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CRP mouse monoclonal antibody,clone OTI1G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRP mouse monoclonal antibody,clone OTI1G10
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".