Antibodies

View as table Download

Rabbit Polyclonal Anti-PHB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHB2 antibody: synthetic peptide directed towards the C terminal of human PHB2. Synthetic peptide located within the following region: KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Rabbit Polyclonal Anti-PHB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHB2 antibody: synthetic peptide directed towards the N terminal of human PHB2. Synthetic peptide located within the following region: WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR

Rabbit Polyclonal antibody to Prohibitin 2 (prohibitin 2)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 45 and 299 of Prohibitin 2 (Uniprot ID#Q99623)

Phb2 Antibody - middle region

Applications IP, WB
Reactivities Mouse
Conjugation Unconjugated

PHB2 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse PHB2

Prohibitin 2 (PHB2) Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-299 of human Prohibitin 2 (Prohibitin 2 (PHB2)) (NP_001138303.1).
Modifications Unmodified

REA Rabbit monoclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated