Rabbit Polyclonal Anti-PRMT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRMT1 antibody: synthetic peptide directed towards the middle region of human PRMT1. Synthetic peptide located within the following region: ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY |
Mouse Monoclonal PRMT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PRMT1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-353 of human PRMT1 (NP_938074.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
