PSME3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSME3 |
PSME3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSME3 |
Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3 |
Rabbit Polyclonal Anti-PSME3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PSME3 antibody is: synthetic peptide directed towards the N-terminal region of Human PSME3. Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ |
Rabbit Polyclonal Anti-PSME3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSME3 antibody: synthetic peptide directed towards the C terminal of human PSME3. Synthetic peptide located within the following region: TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY |
PSME3 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PSME3 (NP_005780.2). |
Modifications | Unmodified |