Antibodies

View as table Download

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: TESAFSAERLVEIAESRFPRYFNTEEKLLLTSSKVHLYRELTCDEVLQRI

Rabbit polyclonal anti-RAD51L1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD51L1.

Rabbit Polyclonal Anti-RAD51L1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51L1 antibody: synthetic peptide directed towards the middle region of human RAD51L1. Synthetic peptide located within the following region: IPVILTNQITTHLSGALASQADLVSPADDLSLSEGTSGSSCVIAALGNTW

Mouse Monoclonal Rad51L1 Antibody (1 H3/13)

Applications WB
Reactivities Human, Primate (Does not react with: Mouse)
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

RAD51B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAD51B

RAD51B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RAD51L1

RAD51B Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-384 of human RAD51B (NP_598193.2).
Modifications Unmodified

RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated

RAD51L1 mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated