Rabbit Polyclonal Slc22A17 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Slc22A17 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Slc22A17. |
Rabbit Polyclonal Slc22A17 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Slc22A17 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Slc22A17. |
Rabbit Polyclonal Anti-SLC22A17 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC22A17 Antibody: synthetic peptide directed towards the middle region of human SLC22A17. Synthetic peptide located within the following region: HCYQPVGGGGSPSDFYLCSLLASGTAALACVFLGVTVDRFGRRGILLLSM |
Carrier-free (BSA/glycerol-free) SLC22A17 mouse monoclonal antibody,clone OTI2D6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-SLC22A17 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 511-524 amino acids of human solute carrier family 22, member 17 |
SLC22A17 mouse monoclonal antibody,clone OTI2D6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SLC22A17 mouse monoclonal antibody,clone OTI2D6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |