Rabbit Polyclonal Anti-TFPI2 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TFPI2 antibody: synthetic peptide directed towards the middle region of human TFPI2. Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT |
Carrier-free (BSA/glycerol-free) TFPI2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFPI2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TFPI2 mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TFPI2 mouse monoclonal antibody, clone OTI1D4 (formerly 1D4)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TFPI2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TFPI2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TFPI2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TFPI2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TFPI2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TFPI2 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TFPI2 mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TFPI2 mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
TFPI2 mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TFPI2 mouse monoclonal antibody, clone OTI5H3 (formerly 5H3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
