Rabbit Polyclonal Anti-Zbtb44 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Zbtb44 antibody is: synthetic peptide directed towards the N-terminal region of Rat Zbtb44. Synthetic peptide located within the following region: VKTFTHSSSSHSQEMLGKLNMLRNDGHFCDITIRVQDRIFRAHKVVLAAC |
Rabbit Polyclonal Anti-ZBTB44 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BTBD15 antibody: synthetic peptide directed towards the C terminal of human BTBD15. Synthetic peptide located within the following region: PVDSSLAFPWTFPFGIDRRIQPEKVKQAENTRTLELPGPSETGRRMADYV |
Rabbit Polyclonal Anti-ZBTB44 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB44 antibody: synthetic peptide directed towards the middle region of human ZBTB44. Synthetic peptide located within the following region: SRRKRKSYIVMSPESPVKCGTQTSSPQVLNSSASYSENRNQPVDSSLAFP |
Carrier-free (BSA/glycerol-free) ZBTB44 mouse monoclonal antibody,clone OTI7F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZBTB44 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human ZBTB44 (NP_001288027.1). |
| Modifications | Unmodified |
ZBTB44 mouse monoclonal antibody,clone OTI7F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ZBTB44 mouse monoclonal antibody,clone OTI7F12
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China