Antibodies

Jump to Filters
View as table Download
ABCA1 Mouse Monoclonal Antibody [Clone ID: AB.H10]
TA309942

USD 270.00

2 Weeks

Mouse anti-ABCA1 monoclonal antibody

Applications WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
ABCA1 Mouse Monoclonal Antibody [Clone ID: HJ1]
TA309556

USD 457.00

3 Weeks

Mouse Monoclonal ABCA1 Antibody (HJ1) - Astrocyte Marker

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ABCA1 Rabbit Polyclonal Antibody
TA309555

USD 479.00

2 Weeks

Rabbit Polyclonal ABCA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information.
ABCA1 (1800-2260) Mouse Monoclonal Antibody [Clone ID: AB1.G6]
AM20835PU-N

USD 385.00

2 Weeks

ABCA1 (1800-2260) mouse monoclonal antibody, clone AB1.G6, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
ABCA1 Rabbit Polyclonal Antibody
TA310028

USD 205.00

3 Weeks

Rabbit anti-ABCA1 polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCA1.
ABCA1 Rabbit Polyclonal Antibody
TA322600

USD 345.00

4 Weeks

Anti-ABCA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.2253~2257(D-E-K-V-K) derived from Human ABCA1.
ABCA1 Rabbit Polyclonal Antibody
TA332061

USD 375.00

5 Days

Rabbit Polyclonal Anti-Abca1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK