Antibodies

Jump to Filters
View as table Download
AKAP1 Rabbit Polyclonal Antibody
TA314719

USD 345.00

In Stock

Rabbit polyclonal anti-AKAP1 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AKAP1.
AKAP1 Rabbit Polyclonal Antibody
AP20535PU-N

USD 407.00

2 Weeks

AKAP1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
AKAP1 Rabbit Polyclonal Antibody
TA341554

USD 375.00

5 Days

Rabbit Polyclonal Anti-AKAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKAP1 antibody: synthetic peptide directed towards the C terminal of human AKAP1. Synthetic peptide located within the following region: VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF