AKAP1 Rabbit Polyclonal Antibody

CAT#: TA341554

Rabbit Polyclonal Anti-AKAP1 Antibody

Product Images

WB Suggested Anti-AKAP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AKAP1 antibody: synthetic peptide directed towards the C terminal of human AKAP1. Synthetic peptide located within the following region: VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: A-kinase anchoring protein 1
• Database Link:
  NP_644804
  Entrez Gene 8165 Human
  UniProt ID Q92667
• Background: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which haveThe common function of binding toThe regulatory subunit of protein kinase A (PKA) and confiningThe holoenzyme to discrete locations withinThe cell.This gene encodes a member ofThe AKAP family.The encoded protein binds to type I and type II regulatory subunits of PKA and anchorsThem toThe mitochondrion.This protein is speculated to be involved inThe cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment. [provided by RefSeq, Jul 2008]
• Synonyms: AKAP; AKAP84; AKAP121; AKAP149; D-AKAP1; MGC1807; PRKA1; SAKAP84
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane