Antibodies

Jump to Filters
View as table Download
AKAP1 Rabbit Polyclonal Antibody
TA314719

USD 345.00

In Stock

Rabbit polyclonal anti-AKAP1 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AKAP1.
AKAP1 Rabbit Polyclonal Antibody
TA590651

USD 409.00

In Stock

Rabbit Polyclonal AKAP1 Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
AKAP1 Rabbit Polyclonal Antibody
AP20535PU-N

USD 407.00

2 Weeks

AKAP1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
AKAP1 Rabbit Polyclonal Antibody
TA341554

USD 375.00

5 Days

Rabbit Polyclonal Anti-AKAP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AKAP1 antibody: synthetic peptide directed towards the C terminal of human AKAP1. Synthetic peptide located within the following region: VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF