Antibodies

View as table Download

Rabbit polyclonal anti-CD79A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD79A.

Rabbit Polyclonal Anti-CD79A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD79A antibody is: synthetic peptide directed towards the C-terminal region of Human CD79A. Synthetic peptide located within the following region: AVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRG

Carrier-free (BSA/glycerol-free) CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-HAO1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD79A

CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

CD79A mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".