Antibodies

View as table Download

Rabbit Polyclonal Anti-LGALS1 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Rabbit polyclonal anti-LGALS1 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human LGALS1.

Galectin 1 (LGALS1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Gst fusion protein from Human Galectin-1

Carrier-free (BSA/glycerol-free) LGALS1 mouse monoclonal antibody,clone OTI1E2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LGALS1 mouse monoclonal antibody,clone OTI7C3

Applications WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Anti-LGALS1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-LGALS1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

LGALS1 mouse monoclonal antibody,clone OTI1E2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

LGALS1 mouse monoclonal antibody,clone OTI1E2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated