Antibodies

View as table Download

Rabbit anti-NUP62 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human NUP62

Rabbit polyclonal antibody to nucleoporin p62 (nucleoporin 62kDa)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 230 and 490 of Nucleoporin p62

Rabbit Polyclonal Anti-NUP62 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NUP62 antibody: synthetic peptide directed towards the N terminal of human NUP62. Synthetic peptide located within the following region: SGFNFGGTGAPTGGFTFGTAKTATTTPATGFSFSTSGTGGFNFGAPFQPA

NUP62 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human NUP62

Rabbit polyclonal antibody to nucleoporin p62 (nucleoporin 62kDa)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 294 and 522 of nucleoporin p62 (Uniprot ID#P37198)

Rabbit Polyclonal Anti-NUP62 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NUP62 antibody is: synthetic peptide directed towards the middle region of Human NUP62. Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA

Rabbit Polyclonal Anti-NUP62 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NUP62