Antibodies

View as table Download

Anti-OLFM1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 90-220 amino acids of human olfactomedin 1

Rabbit Polyclonal Antibody against OLFM1 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Olfm1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 71-100 amino acids from the N-terminal region of human Olfm1.

Rabbit Polyclonal Antibody against OLFM1 (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Olfm1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 434-463 amino acids from the C-terminal region of human Olfm1.

Rabbit Polyclonal Anti-OLFM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OLFM1 antibody is: synthetic peptide directed towards the N-terminal region of Human OLFM1. Synthetic peptide located within the following region: VLPTNPEESWQVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEK

Rabbit Polyclonal Anti-OLFM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OLFM1 antibody is: synthetic peptide directed towards the C-terminal region of Human OLFM1. Synthetic peptide located within the following region: EKVQNMSQSIEVLDRRTQRDLQYVEKMENQMKGLESKFKQVEESHKQHLA