Antibodies

View as table Download

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2B subunit

GRIA3 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIA3

Goat Anti-GRIK3 / GLUR7 Antibody

Applications WB
Reactivities Rat, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-KIRQLPIDSDDSRP, from the internal region of the protein sequence according to NP_000822.2.

Rabbit Polyclonal GluR1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GluR1

Rabbit Polyclonal Grik1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Grik1 antibody was raised against a 16 amino acid peptide near the center of the human Grik1.

Rabbit Polyclonal Grik4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Grik4 antibody was raised against a 14 amino acid peptide near the amino terminus of the human Grik4.

Rabbit Polyclonal Grik5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Grik5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human Grik5.

Rabbit anti-GRIA1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIA1

Rabbit Polyclonal GluR5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human GluR5.

Rabbit Polyclonal NMDAR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR1

Rabbit anti-GRIK2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIK2

Rabbit Anti-NMDA NR2C Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the N-terminal region of the NR2C subunit

Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H).
Modifications Phospho-specific

Rabbit Polyclonal GluR1 (Ser863) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GluR1 around the phosphorylation site of Serine 863
Modifications Phospho-specific

Rabbit polyclonal GluR5 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GluR5.

Rabbit Polyclonal Anti-Phospho-NMDAR1(Ser897) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-NMDAR1(Ser897) Antibody: A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Sersine 897
Modifications Phospho-specific

Goat Anti-GRIA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KKLDQREYPGSETP, from the internal region of the protein sequence according to NP_000820.3; NP_001070711.1; NP_001070712.1.

Rabbit Polyclonal Grik1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Grik1 antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human Grik1.

Rabbit Polyclonal Grik4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Grik4 antibody was raised against a 19 amino acid peptide near the carboxy terminus of the human Grik4.

Rabbit polyclonal GRIN2B(Ab-1303) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D).

Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K).

Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K).
Modifications Phospho-specific

Rabbit polyclonal anti-GRID2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRID2.

Rabbit Polyclonal NMDAR2B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR2B

Rabbit Polyclonal NMDAR2B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR2B

Rabbit Polyclonal NMDAR2B (Tyr1336) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1336
Modifications Phospho-specific

Rabbit Polyclonal NMDAR2B (Tyr1474) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR2B around the phosphorylation site of Tyrosine 1474
Modifications Phospho-specific

Rabbit Polyclonal NMDAR1 (Ser890) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Serine 890
Modifications Phospho-specific

Rabbit Polyclonal NMDAR1 (Ser897) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR1 around the phosphorylation site of Serine 897
Modifications Phospho-specific

Rabbit polyclonal GRIN2B (Phospho-Ser1303) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D).
Modifications Phospho-specific

Goat Polyclonal Antibody against GRIK1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence QCKQTHPTNSTS, from the internal region (near the C Terminus) of the protein sequence according to NP_000821.1; NP_783300.1.

Mouse Monoclonal anti-NR2B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GRIN1 (Phospho-Ser896) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 896 (R-R-S(p)-S-K) derived from Human NMDAR1.
Modifications Phospho-specific

Rabbit Polyclonal NMDAR1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human NMDAR1

Rabbit Polyclonal Grik2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Grik2 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Grik2.

Rabbit Polyclonal Grik3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Grik3 antibody was raised against a 13 amino acid peptide near the amino terminus of the human Grik3.

Rabbit Anti-NMDA NR2A Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2A subunit

Rabbit Anti-NMDA NR2A Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2A subunit

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2B subunit

Anti-GRIA1 (phospho-Ser849) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 849 (Q-Q-S(p)-I-N ) derived from Human GluR1.
Modifications Phospho-specific

Anti-GRIA2 (phospho-Ser880) Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 880 (I-E-S(p)-V-K) derived from Human Glutamate receptor 2.
Modifications Phospho-specific

Phospho-GRIN1-S896 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S896 of human GRIN1
Modifications Phospho-specific

Phospho-GRIA2-S880 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S880 of human GRIA2
Modifications Phospho-specific

Phospho-GRIA1-S836 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S836 of human GRIA1
Modifications Phospho-specific

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Gria3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDIV

Anti-GRIN2B Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1413-1425 amino acids of Human glutamate receptor, ionotropic, N-methyl D-aspartate 2B

GRIA2 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2

Rabbit Polyclonal anti-GRIN2A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIN2A