Antibodies

View as table Download

Rabbit Polyclonal antibody to KYNU (kynureninase (L-kynurenine hydrolase))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 114 and 329 of KYNU (Uniprot ID#Q16719)

Rabbit Polyclonal Anti-KYNU Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the C terminal of human KYNU. Synthetic peptide located within the following region: LAHAVGNVELYLHDWGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKP

L Kynurenine Hydrolase (KYNU) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human KYNU

Rabbit Polyclonal Anti-KYNU Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KYNU antibody: synthetic peptide directed towards the N terminal of human KYNU. Synthetic peptide located within the following region: MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPK

Carrier-free (BSA/glycerol-free) KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), Biotinylated

Applications IHC, WB
Reactivities Human, Rat
Conjugation Biotin

Purified KYNU mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), HRP conjugated

Applications IHC, WB
Reactivities Human, Rat
Conjugation HRP