Antibodies

Jump to Filters
View as table Download
BACE2 Rabbit Polyclonal Antibody
TA306031

USD 430.00

In Stock

Rabbit Polyclonal BACE2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BACE2 antibody was raised against a synthetic peptide corresponding to amino acids 44 to 59 of human BACE2.
BACE2 (44-59) Rabbit Polyclonal Antibody
AP22917PU-N

USD 525.00

2 Weeks

BACE2 (44-59) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen BACE2 antibody was raised against synthetic peptide (aptpgpgtpaerhadg) corresponding to amino acids 44 to 59 of human BACE2
BACE2 (N-term) Rabbit Polyclonal Antibody
RA25043-50

USD 450.00

2 Weeks

BACE2 (N-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BACE2 Rabbit Polyclonal Antibody
TA306032

USD 430.00

5 Days

Rabbit Polyclonal BACE2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen BACE2 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BACE2.
BACE2 Rabbit Polyclonal Antibody
TA341893

USD 375.00

5 Days

Rabbit Polyclonal Anti-BACE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the middle region of human BACE2. Synthetic peptide located within the following region: SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
BACE2 Rabbit Polyclonal Antibody
TA341894

USD 375.00

5 Days

Rabbit Polyclonal Anti-BACE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE2 antibody: synthetic peptide directed towards the N terminal of human BACE2. Synthetic peptide located within the following region: PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG