Antibodies

View as table Download

Rabbit Polyclonal MCSF Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Anti-CSF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP

Rabbit Polyclonal Anti-CSF1 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG

M-CSF (CSF1) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human M-CSF

Rabbit Polyclonal Anti-CSF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the N terminal of human CSF1. Synthetic peptide located within the following region: PPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME

Carrier-free (BSA/glycerol-free) CSF1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) CSF1 mouse monoclonal antibody, clone OTI8E1 (formerly 8E1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CSF1 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CSF1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)

Applications WB
Reactivities Human
Conjugation Unconjugated

CSF1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CSF1 mouse monoclonal antibody, clone OTI1D10 (formerly 1D10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CSF1 mouse monoclonal antibody, clone OTI8E1 (formerly 8E1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CSF1 mouse monoclonal antibody, clone OTI8E1 (formerly 8E1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CSF1 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CSF1 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CSF1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)

Applications WB
Reactivities Human
Conjugation Unconjugated

CSF1 mouse monoclonal antibody, clone OTI1F8 (formerly 1F8)

Applications WB
Reactivities Human
Conjugation Unconjugated