Antibodies

View as table Download

Goat Anti-RORC (aa200-212) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CHLEYSPERGKAE, from the internal region of the protein sequence according to NP_005051.2; NP_001001523.1.

Mouse Monoclonal ROR gamma/RORC/NR1F3 Antibody (4G419)

Applications FC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Rabbit Polyclonal Anti-RORC Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC antibody is: synthetic peptide directed towards the N-terminal region of Human RORC. Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG

Rabbit polyclonal anti-RORG antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RORG.

Rabbit Polyclonal ROR gamma/RORC/NR1F3 Antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 1-50 of human ROR gamma was used as the immunogen.

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORC antibody: synthetic peptide directed towards the N terminal of human RORC. Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the C terminal of human RORC. Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA

Rabbit Polyclonal Anti-RORC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the middle region of human RORC. Synthetic peptide located within the following region: CHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPD

Rabbit Polyclonal Anti-Rorc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG

Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI3C12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI3C9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RORC mouse monoclonal antibody,clone OTI1G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI3C12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI3C12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI3C9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI3C9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI1G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RORC mouse monoclonal antibody,clone OTI1G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated