Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIM21 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TRIM21 antibody was raised against an 16 amino acid peptide near the center of human TRIM21.

Rabbit polyclonal SREBF2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SREBF2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 399-427 amino acids from the Central region of human SREBF2.

Rabbit Polyclonal Anti-SREBF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: VMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIEL

Rabbit Polyclonal Anti-SREBF2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: PASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRIL

Carrier-free (BSA/glycerol-free) SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SREBF2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated