Antibodies

View as table Download

Mouse Monoclonal Syntenin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti-SDCBP Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human SDCBP

Rabbit Polyclonal Anti-SDCBP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: VGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLV

Goat Polyclonal Antibody against SDCBP

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence SLEDLKVDKVIQAQ-C, from the N Terminus of the protein sequence according to NP_005616.2; NP_001007068.1; NP_001007069; NP_001007070.1; NP_001007071.1.

Rabbit Polyclonal Anti-SDCBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: NSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDR

Rabbit Polyclonal Anti-SDCBP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SDCBP Antibody: synthetic peptide directed towards the middle region of human SDCBP. Synthetic peptide located within the following region: NGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTV

Carrier-free (BSA/glycerol-free) SDCBP mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-SDCBP Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

SDCBP (Syntenin) mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SDCBP (Syntenin) mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SDCBP mouse monoclonal antibody,clone UMAB69

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SDCBP mouse monoclonal antibody,clone UMAB69

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SDCBP mouse monoclonal antibody,clone UMAB69

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated