Antibodies

View as table Download

SFRP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 33~63 amino acids from the N-terminal region of Human SFRP1.

Rabbit polyclonal anti-SFRP1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SFRP1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a 12 aa region of human Sfrp1 protein.

Rabbit Polyclonal Anti-SFRP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRP1 antibody: synthetic peptide directed towards the middle region of human SFRP1. Synthetic peptide located within the following region: HQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPT