Antibodies

View as table Download

Rabbit anti-APTX Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human APTX

Rabbit Polyclonal Anti-APTX Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APTX antibody: synthetic peptide directed towards the C terminal of human APTX. Synthetic peptide located within the following region: VIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHWTQ

Rabbit Polyclonal Anti-APTX Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-APTX Antibody: synthetic peptide directed towards the middle region of human APTX. Synthetic peptide located within the following region: YPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGSN

Rabbit Polyclonal Anti-APTX Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for Anti-APTX Antibody: synthetic peptide directed towards the N terminal of human APTX. Synthetic peptide located within the following region: MMRVCWLVRQDSRHQRIRLPHLEAVVIGRGPETKITDKKCSRQQVQLKAE