Rabbit Polyclonal Anti-ATOH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATOH1 antibody: synthetic peptide directed towards the middle region of human ATOH1. Synthetic peptide located within the following region: QLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRS |
Rabbit Polyclonal Anti-Atoh1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Atoh1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Atoh1. Synthetic peptide located within the following region: EEWAEVKELGDHHRHPQPHHIPQLTPQPPATLQARDHPVYPAELSLLDST |
ATOH1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 215-354 of human ATOH1 (NP_005163.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
