Atoh1 Rabbit Polyclonal Antibody

CAT#: TA343513

Rabbit Polyclonal Anti-Atoh1 Antibody

Product Images

Host: Rabbit; Target Name: Atoh1; Sample Tissue: Rat Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Atoh1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Atoh1. Synthetic peptide located within the following region: EEWAEVKELGDHHRHPQPHHIPQLTPQPPATLQARDHPVYPAELSLLDST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: atonal bHLH transcription factor 1
• Database Link:
  NP_001102708
  Entrez Gene 500156 Rat
• Background: The function of this protein remains unknown.
• Synonyms: ATH1; bHLHa14; HATH1; MATH-1; Math1
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 79%